Oct-1 (POU2F1) Rabbit Polyclonal Antibody

CAT#: TA330068

Rabbit Polyclonal Anti-POU2F1 Antibody

Product Images

WB Suggested Anti-POU2F1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293TPOU2F1 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: POU class 2 homeobox 1
• Database Link:
  NP_002688
  Entrez Gene 5451 Human
  UniProt ID P14859
• Background: POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region.
• Synonyms: oct-1B; OCT1; OTF1
• Note: Immunogen sequence homology: Chicken: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Rat: 92%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors