Rabbit Polyclonal Anti-TFEB Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP |
Rabbit Polyclonal Anti-TFEB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFEB antibody: synthetic peptide directed towards the C terminal of human TFEB. Synthetic peptide located within the following region: SLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL |
Rabbit Polyclonal TFEB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TFEB |
Rabbit polyclonal antibody to TFEB (transcription factor EB)
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 44 of TFEB (Uniprot ID#P19484) |
Rabbit Polyclonal Anti-TFEB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR |
Germany
Japan
United Kingdom
China
