Antibodies

View as table Download

Rabbit Polyclonal Anti-APOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOB antibody: synthetic peptide directed towards the middle region of human APOB. Synthetic peptide located within the following region: SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

Anti-APOB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen)

Anti-APOB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2158-2177 amino acids of human apolipoprotein B (including Ag(x) antigen)