Antibodies

View as table Download

DNAJB11 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-DNAJB11 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DNAJB11.

Rabbit polyclonal DNAJB11 Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DNAJB11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 63-92 amino acids from the N-terminal region of human DNAJB11.

Rabbit Polyclonal Anti-DNAJB11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNAJB11 antibody: synthetic peptide directed towards the C terminal of human DNAJB11. Synthetic peptide located within the following region: FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY