Rabbit anti-HFE2 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HFE2 |
Rabbit anti-HFE2 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HFE2 |
USD 450.00
2 Weeks
Repulsive Guidance Molecule C (HFE2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | This HFE2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 308-338 amino acids from the C-terminal region of human HFE2. |
USD 450.00
2 Weeks
Repulsive Guidance Molecule C (HFE2) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 141~170 amino acids from the Central region of Human HFE2 / Hemojuvelin |
Rabbit Polyclonal Anti-HFE2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HFE2 antibody: synthetic peptide directed towards the N terminal of human HFE2. Synthetic peptide located within the following region: SSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSA |