Antibodies

View as table Download

Rabbit Polyclonal Anti-METTL7A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL7A antibody: synthetic peptide directed towards the N terminal of human METTL7A. Synthetic peptide located within the following region: MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN

Rabbit Polyclonal MettL7A Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MettL7A antibody was raised against a 13 amino acid peptide near the center of human MettL7A.

METTL7A rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Immunogen METTL7A antibody was raised against mettL7A antibody was raised against a 13 amino acid peptide near the center of Human MettL7A.

Rabbit Polyclonal MettL7A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen MettL7A antibody was raised against a 12 amino acid peptide near the carboxy terminus of human MettL7A.