Antibodies

Jump to Filters
View as table Download
SFTPC Rabbit Polyclonal Antibody
TA332441

USD 275.00

3 Weeks

Rabbit anti-SFTPC Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SFTPC
SFTPC (N-term) Rabbit Polyclonal Antibody
AP53886PU-N

USD 450.00

2 Weeks

SFTPC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Bovine, Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SFTPC.
SFTPC Rabbit Polyclonal Antibody
TA346095

USD 475.00

5 Days

Rabbit Polyclonal Anti-SFTPC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFTPC antibody: synthetic peptide directed towards the N terminal of human SFTPC. Synthetic peptide located within the following region: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI