Antibodies

Jump to Filters
View as table Download
Glycoprotein VI (GP6) Rabbit Polyclonal Antibody
TA306632

USD 430.00

5 Days

Rabbit Polyclonal GPVI Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPVI antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human GPVI.
Glycoprotein VI (GP6) Rabbit Polyclonal Antibody
TA306633

USD 430.00

5 Days

Rabbit Polyclonal GPVI Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPVI antibody was raised against a 18 amino acid synthetic peptide near the center of the human GPVI. The immunogen is located within amino acids 130 - 180 of GPVI.
Glycoprotein VI (GP6) Rabbit Polyclonal Antibody
TA342010

USD 375.00

5 Days

Rabbit Polyclonal Anti-GP6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GP6 antibody: synthetic peptide directed towards the middle region of human GP6. Synthetic peptide located within the following region: PPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYY