USD 360.00
2 Weeks
Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
USD 360.00
2 Weeks
Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Semaphorin 3B (SEMA3B) (100-200) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Cripto1 (TDGF1) rabbit polyclonal antibody
Applications | FC, IF, WB |
Reactivities | Bovine, Canine, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NUCB2 Antibody
Applications | IHC, WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
Bmi1 (COMMD3-BMI1) (1-100) rabbit polyclonal antibody
Applications | IF, WB |
Reactivities | Bovine, Canine, Chicken, Feline, Human, Mouse, Primate, Rabbit, Rat, Zebrafish |
Conjugation | Unconjugated |
Angiopoietin 1 (ANGPT1) (C-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Canine, Human, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal S1P5/EDG-8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387. |
Rabbit Polyclonal Anti-TNFRSF9 Antibody
Applications | WB |
Reactivities | Canine, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |
Rabbit Polyclonal MTSS1 Antibody
Applications | WB |
Reactivities | Canine, Chicken, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 150-200 of human MTSS1 protein was used as the immunogen. |