Antibodies

View as table Download

Rabbit polyclonal antibody to Adenosine Deaminase (adenosine deaminase, RNA-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 472 and 757 of ADAR1 (Uniprot ID#P55265)

Rabbit Polyclonal Anti-ADAR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAR antibody: synthetic peptide directed towards the C terminal of human ADAR. Synthetic peptide located within the following region: RMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHR

Rabbit polyclonal anti-ADAR1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ADAR1.

Rabbit Polyclonal Anti-ADAR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAR antibody: synthetic peptide directed towards the N terminal of human ADAR. Synthetic peptide located within the following region: GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIAVS

Anti-ADAR Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1191-1205 amino acids of human adenosine deaminase, RNA-specific

Anti-ADAR Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1191-1205 amino acids of human adenosine deaminase, RNA-specific

ADAR1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ADAR11 (NP_001102.2).
Modifications Unmodified