CHM rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHM |
CHM rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHM |
Rabbit Polyclonal Anti-CHM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHM antibody: synthetic peptide directed towards the N terminal of human CHM. Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE |
CHM rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHM |
CHM Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human CHM (NP_000381.1). |
Modifications | Unmodified |