Rabbit Polyclonal Anti-CMAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CMAS antibody: synthetic peptide directed towards the N terminal of human CMAS. Synthetic peptide located within the following region: GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF |
CMAS rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CMAS |
CMAS Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-263 of human CMAS (NP_061156.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
