Rabbit Polyclonal Anti-MCM5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MCM5 |
Rabbit Polyclonal Anti-MCM5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MCM5 |
Rabbit anti-MCM5 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MCM5 |
Rabbit polyclonal anti-MCM5 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MCM5 antibody. |
Rabbit Polyclonal Anti-MCM5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCM5 Antibody: A synthesized peptide derived from human MCM5 |
Rabbit polyclonal anti-MMP-11 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-11 antibody. |
Rabbit Polyclonal Anti-MCM5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCM5 antibody: synthetic peptide directed towards the N terminal of human MCM5. Synthetic peptide located within the following region: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG |
Rabbit anti MCM5 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
MCM5 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MCM5 |
MCM5 Rabbit polyclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human MCM5 (NP_006730.2). |
Modifications | Unmodified |
MCM5 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human MCM5 |
MCM5 Rabbit monoclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |