Antibodies

View as table Download

Rabbit Polyclonal Anti-MAP3K7IP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K7IP2 antibody: synthetic peptide directed towards the N terminal of human MAP3K7IP2. Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG

Rabbit Polyclonal TAB2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen TAB2 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human TAB2.

TAB2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-693 of human TAB2 (NP_001278963.1).
Modifications Unmodified