TAB2 Rabbit Polyclonal Antibody

CAT#: TA330285

Rabbit Polyclonal Anti-MAP3K7IP2 Antibody

Product Images

WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysateTAB2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Human Stomach

• 

  Human Spermatophore

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAP3K7IP2 antibody: synthetic peptide directed towards the N terminal of human MAP3K7IP2. Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: TGF-beta activated kinase 1/MAP3K7 binding protein 2
• Database Link:
  NP_055908
  Entrez Gene 23118 Human
  UniProt ID Q9NYJ8
• Background: MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.
• Synonyms: CHTD2; MAP3K7IP2; TAB-2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: MAPK signaling pathway, NOD-like receptor signaling pathway, Toll-like receptor signaling pathway