Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TAF1A antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF1A. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TAF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the C terminal of human TAF1A. Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL |
Rabbit Polyclonal Anti-TAF1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the N terminal of human TAF1A. Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI |
Rabbit Polyclonal Anti-Taf1a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Taf1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Taf1a. Synthetic peptide located within the following region: FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII |
Active filters
Target Symbol
- TAF1A
Antibody Hosts
- Rabbit
Isotypes
- IgG