Taf1a Rabbit Polyclonal Antibody

CAT#: TA342345

Rabbit Polyclonal Anti-Taf1a Antibody

Product Images

Host: Rabbit; Target Name: Taf1a; Sample Tissue: Rat Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Taf1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Taf1a. Synthetic peptide located within the following region: FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: TATA-box binding protein associated factor, RNA polymerase I, A
• Database Link:
  NP_067441
  Entrez Gene 360893 Rat
  UniProt ID P97357
• Background: Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits.
• Synonyms: MGC:17061; OTTHUMP00000035654; RAFI48; SL1; TAFI48
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Rabbit: 92%; Horse: 91%; Pig: 86%; Guinea pig: 86%