Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TAF1A antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF1A. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TAF1A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the C terminal of human TAF1A. Synthetic peptide located within the following region: CEKAFVAGLLLGKGCRYFRYILKQDHQILGKKIKRMKRSVKKYSIVNPRL |
TAF1 48 (TAF1A) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 67-97 amino acids from the N-terminal region of human TAF1A |
Rabbit Polyclonal Anti-TAF1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF1A antibody: synthetic peptide directed towards the N terminal of human TAF1A. Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI |
Rabbit Polyclonal Anti-Taf1a Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Taf1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Taf1a. Synthetic peptide located within the following region: FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII |
Carrier-free (BSA/glycerol-free) TAF1A mouse monoclonal antibody,clone OTI8C10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
TAF1A mouse monoclonal antibody,clone OTI8C10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TAF1A mouse monoclonal antibody,clone OTI8C10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TAF1A mouse monoclonal antibody,clone OTI8C10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TAF1A mouse monoclonal antibody,clone OTI8C10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TAF1A