Antibodies

View as table Download

Rabbit polyclonal TOB1 (Ser164) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TOB1 around the phosphorylation site of serine 164 (A-V-SP-P-T).
Modifications Phospho-specific

Rabbit polyclonal anti-HER2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HER2.

Rabbit polyclonal TOB1 (Ab-164) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TOB1 around the phosphorylation site of serine 164 (A-V-SP-P-T).

Rabbit Polyclonal Anti-TOB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOB1 antibody: synthetic peptide directed towards the middle region of human TOB1. Synthetic peptide located within the following region: DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT

Rabbit Polyclonal Anti-TOB1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TOB1 antibody: synthetic peptide directed towards the middle region of mouse TOB1. Synthetic peptide located within the following region: QPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK

TOB1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TOB1 (NP_005740.1).
Modifications Unmodified