SEMA4A rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEMA4A rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEMA4A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 150-180 amino acids from the N-terminal region of Human SEMA4A |
Rabbit Polyclonal Anti-SEMA4A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SEMA4A Antibody: synthetic peptide directed towards the N terminal of human SEMA4A. Synthetic peptide located within the following region: PSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFL |
Rabbit Polyclonal Anti-SEMA4A rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SEMA4A |