DHX58 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | DHX58 antibody was raised against 11 amino acid peptide from near the center of human LGP2 |
DHX58 rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | DHX58 antibody was raised against 11 amino acid peptide from near the center of human LGP2 |
Rabbit Polyclonal LGP2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LGP2 antibody was raised against a 11 amino acid peptide from near the center of human LGP2. |
Rabbit Polyclonal LGP2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LGP2 antibody was raised against a 12 amino acid peptide from near the carboxy terminus of human LGP2. |
Rabbit Polyclonal LGP2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LGP2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human LGP2. |
Rabbit Polyclonal Anti-DHX58 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DHX58 antibody: synthetic peptide directed towards the N terminal of human DHX58. Synthetic peptide located within the following region: AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM |