Antibodies

View as table Download

ESRP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ESRP2

Rabbit Polyclonal Anti-RBM35B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBM35B antibody: synthetic peptide directed towards the N terminal of human RBM35B. Synthetic peptide located within the following region: ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ

Rabbit Polyclonal RBM35B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RBM35B antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human RBM35B.

ESRP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ESRP2