Antibodies

View as table Download

Rabbit Polyclonal FTO Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FTO antibody was raised against a 15 amino acid synthetic peptide from near the amino terminus of human FTO. The immunogen is located within the first 50 amino acids of FTO.

Rabbit Polyclonal FTO Antibody

Applications WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide within the C-terminal region (residues 400-505) of the human FTO protein. [Swiss-Prot# Q9C0B1]

Rabbit Polyclonal Anti-FTO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FTO antibody: synthetic peptide directed towards the middle region of human FTO. Synthetic peptide located within the following region: WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA

Rabbit Polyclonal Anti-FTO Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FTO

FTO rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FTO

FTO Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 416-505 of human FTO (NP_001073901.1).
Modifications Unmodified

FTO Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FTO.

FTO Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human FTO. AA range:19-68

FTO Rabbit monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated