Rabbit Polyclonal ORAI2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ORAI2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human ORAI2. |
Rabbit Polyclonal ORAI2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ORAI2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human ORAI2. |
Rabbit Polyclonal Anti-Orai2
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CPEPGHKGMDYRDWVRR, corresponding to amino acid residues 16-32 of mouse Orai2. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-ORAI2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ORAI2 antibody: synthetic peptide directed towards the middle region of human ORAI2. Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ |