Antibodies

Jump to Filters
View as table Download
ORAI2 Rabbit Polyclonal Antibody
TA306419

USD 430.00

5 Days

Rabbit Polyclonal ORAI2 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ORAI2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human ORAI2.
Orai2 Rabbit Polyclonal Antibody
TA328751

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Orai2

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide CPEPGHKGMDYRDWVRR, corresponding to amino acid residues 16-32 of mouse Orai2. Intracellular, N-terminus.
ORAI2 Rabbit Polyclonal Antibody
TA339631

USD 375.00

5 Days

Rabbit Polyclonal Anti-ORAI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORAI2 antibody: synthetic peptide directed towards the middle region of human ORAI2. Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ