Antibodies

View as table Download

Rabbit Polyclonal RUNX2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human RUNX2 protein (within residues 225-300). [Swiss-Prot Q13950]

RUNX2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RUNX2

Rabbit polyclonal RUNX2 Antibody (S533)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RUNX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids surrounding S533 of human RUNX2.

Rabbit Polyclonal Anti-RUNX2 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the C terminal of human RUNX2. Synthetic peptide located within the following region: TTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY

Rabbit Polyclonal RUNX2/CBFA1 Antibody

Applications WB
Reactivities Human, Mouse, Chicken, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to somewhere between amino acids 250-300 of human RUNX2 was used as immunogen for this antibody.RUNX2 and RUNX1 share an approximate 66% homology in peptide sequence used as immunogen.

Rabbit Polyclonal Anti-RUNX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the middle region of human RUNX2. Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

Rabbit Polyclonal Anti-RUNX2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the N terminal of human RUNX2. Synthetic peptide located within the following region: MRIPVDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQ

Anti-CBFA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 320-336 amino acids of Human Core-binding factor subunit alpha-1

Rabbit Polyclonal Anti-RUNX2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RUNX2

RUNX2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RUNX2

RUNX2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 242-521 of human RUNX2 (NP_001019801.3).
Modifications Unmodified

Rabbit polyclonal anti-RUNX2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RUNX2

Rabbit polyclonal anti-RUNX2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RUNX2