Antibodies

View as table Download

Rabbit Polyclonal Anti-TNFRSF9 Antibody

Applications WB
Reactivities Canine, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

Rabbit Polyclonal Anti-TNFRSF9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFRSF9

TNFRSF9 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TNFRSF9

4-1BB/CD137 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human 4-1BB/CD137 (NP_001552.2).
Modifications Unmodified

Recombinant Anti-4-1BB (Clone 4B4-1-1)

Applications ELISA, FC, IHC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques.