Rabbit Polyclonal Anti-CD253 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
Rabbit Polyclonal Anti-CD253 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
Rabbit Polyclonal Trail Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail. |
Rabbit polyclonal anti-CD253 / TNFSF10 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD253. |
Rabbit anti CD253/TRAIL/ (TNFSF10) (IN1) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of TRAIL protein (from 115aa-140aa). This sequence is identical to human and mouse. |
Anti-Human sTRAIL/Apo2L Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTRAIL/Apo2L |
Rabbit Polyclonal Anti-TNFSF10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFSF10 antibody: synthetic peptide directed towards the N terminal of human TNFSF10. Synthetic peptide located within the following region: CFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQE |
Rabbit anti CD253/TRAIL (IN2) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the internal sequence of human TRAIL protein (from 160aa-190aa). This sequence is has one amino acid difference from rat origin. |
Rabbit anti CD253/TRAIL (CT) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of TRAIL protein (from 230aa-280aa). This sequence is identical to human, rat and mouse. |
TNFSF10 rabbit polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFSF10 |
TNFSF10 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFSF10 |
TNFSF10 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 39-250 of human TNFSF10 (NP_003801.1). |
Modifications | Unmodified |