Rabbit Polyclonal ECSIT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ECSIT antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human ECSIT. |
Rabbit Polyclonal ECSIT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ECSIT antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human ECSIT. |
Rabbit Polyclonal Anti-Ecsit Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ecsit antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN |
Rabbit Polyclonal Anti-Ecsit Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SITPEC antibody: synthetic peptide directed towards the middle region of mouse SITPEC. Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP |
ECSIT Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-296 of human ECSIT (NP_001135936.1). |
Modifications | Unmodified |