Antibodies

Jump to Filters
View as table Download
ECSIT Rabbit Polyclonal Antibody
TA306185

USD 430.00

5 Days

Rabbit Polyclonal ECSIT Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ECSIT antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human ECSIT.
Ecsit Rabbit Polyclonal Antibody
TA342302

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ecsit Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ecsit antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN
ECSIT Rabbit Polyclonal Antibody
TA342303

USD 310.00

5 Days

Rabbit Polyclonal Anti-Ecsit Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SITPEC antibody: synthetic peptide directed towards the middle region of mouse SITPEC. Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP
ECSIT Rabbit Polyclonal Antibody
TA375702

USD 220.00

3 Weeks

ECSIT Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-296 of human ECSIT (NP_001135936.1).
Modifications Unmodified