Antibodies

View as table Download

Rabbit Polyclonal Anti-MYBBP1A Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MYBBP1A antibody: synthetic peptide directed towards the C terminal of mouse MYBBP1A. Synthetic peptide located within the following region: DAVTEGAMPAATGKDQPPSTGKKKRKRVKASTPSQVNGITGAKSPAPSNP

Rabbit Polyclonal Anti-Mybbp1a Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mybbp1a antibody: synthetic peptide directed towards the middle region of mouse Mybbp1a. Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ

Mybbp1a Antibody - C-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse Mybbp1a

MYBBP1A Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1104-1328 of human MYBBP1A (NP_055335.2).
Modifications Unmodified