Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-TEM-8/ATR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 484 of Mouse TEM8 |
Rabbit Polyclonal Anti-ANTXR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANTXR1 antibody: synthetic peptide directed towards the middle region of human ANTXR1. Synthetic peptide located within the following region: VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK |
Anti-ANTXR1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-332 amino acids of human anthrax toxin receptor 1 |
ANTXR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 84-333 of human ANTXR1 (NP_060623.2). |
| Modifications | Unmodified |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- ANTXR1
Antibody Hosts
- Rabbit