Antibodies

Jump to Filters
View as table Download
Cholecystokinin (CCK) Rabbit Polyclonal Antibody
AP20643PU-N

USD 370.00

2 Weeks

Cholecystokinin (CCK) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 21-70 of Human CCK.
Cholecystokinin (CCK) Rabbit Polyclonal Antibody
TA334300

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCK antibody: synthetic peptide directed towards the middle region of human CCK. Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Cholecystokinin (CCK) Rabbit Polyclonal Antibody
TA364046

USD 690.00

2 Weeks

Rabbit polyclonal anti Cholecystokinin Octapeptide (desulfated); diluted antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 coupled to carrier protein.
Cholecystokinin (CCK) Rabbit Polyclonal Antibody
TA364048

USD 400.00

2 Weeks

Rabbit polyclonal anti Cholecystokinin Octapeptide (desulfated); neat antiserum

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 coupled to carrier protein.
Cholecystokinin (CCK) Rabbit Polyclonal Antibody
TA364052

USD 655.00

2 Weeks

Rabbit polyclonal anti Cholecystokinin Octapeptide (desulfated); purified rabbit IgG

Applications ELISA
Reactivities Human, Mammalian
Conjugation Unconjugated
Immunogen Synthetic peptide H-Asp-Tyr-Met-Gly-Trp-Met-Asp-Phe-NH2 coupled to a carrier protein.
CCK Rabbit Polyclonal Antibody
TA364434

USD 380.00

4 Weeks

CCK rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CCK