CELA1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CELA1 |
CELA1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CELA1 |
CELA1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Porcine |
Immunogen | Elastase isolated and purified from Porcine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CELA1 rabbit polyclonal antibody, Serum
Applications | ELISA, WB |
Reactivities | Porcine |
Immunogen | Elastase from Porcine pancreas. |
CELA1 rabbit polyclonal antibody, Biotin, Purified
Applications | ELISA, WB |
Reactivities | Porcine |
Conjugation | Biotin |
Immunogen | Elastase from porcine pancreas |
CELA1 rabbit polyclonal antibody, HRP, Purified
Applications | ELISA, WB |
Reactivities | Porcine |
Conjugation | HRP |
Immunogen | Elastase from porcine pancreas |
CELA1 rabbit polyclonal antibody, Purified
Applications | ELISA, WB |
Reactivities | Porcine |
Immunogen | Elastase from porcine pancreas |
Rabbit Polyclonal Anti-ELA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ELA1 antibody: synthetic peptide directed towards the N terminal of human ELA1. Synthetic peptide located within the following region: LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT |
Rabbit Polyclonal Anti-Ela1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Ela1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV |
CELA1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CELA1 |