Antibodies

View as table Download

Biotinylated Anti-Human M-CSF Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human M-CSF

Rabbit Polyclonal MCSF Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

CSF1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CSF1

Anti-Human M-CSF Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human M-CSF

Rabbit Polyclonal Anti-CSF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP

Rabbit Polyclonal Anti-CSF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG

M-CSF (CSF1) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human M-CSF

Rabbit Polyclonal Anti-CSF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1. Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME

CSF1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CSF1

CSF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 33-190 of human CSF1 (NP_757351.1).
Modifications Unmodified