Antibodies

View as table Download

Rabbit Polyclonal CX3CL1/Fractalkine Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human CX3CL protein (within residues 20-150). [Swiss-Prot P78423]

Rabbit polyclonal anti-CX3CL1 (Fractalkine) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human Fractalkine

Rabbit Polyclonal CX3CL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CX3CL1 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human CX3CL1 .

Anti-Human Fractalkine Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Fractalkine (CX3CL1)

Rabbit Polyclonal Anti-CX3CL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CX3CL1 antibody is: synthetic peptide directed towards the middle region of Human CX3CL1. Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ

Anti-CX3CL1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 368-381 amino acids of Human chemokine (C-X3-C motif) ligand 1

CX3CL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CX3CL1

CX3CL1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CX3CL1

CX3CL1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 365-397aa of human CX3CL1 (NP_002987.1).
Modifications Unmodified