Antibodies

Jump to Filters
View as table Download
CYP46 (CYP46A1) Rabbit Polyclonal Antibody
TA301675

USD 424.00

5 Days

Rabbit Polyclonal Antibody against Cyp-46

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to residues between 200-250 of human Cyp46.
CYP46 (CYP46A1) Rabbit Polyclonal Antibody
TA332027

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP46A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP46A1 Antibody: synthetic peptide directed towards the C terminal of human CYP46A1. Synthetic peptide located within the following region: YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM
CYP46 (CYP46A1) Rabbit Polyclonal Antibody
TA351117

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYP46A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP46A1
CYP46A1 Rabbit Polyclonal Antibody
TA367025

USD 380.00

4 Weeks

CYP46A1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYP46A1
CYP46 (CYP46A1) Rabbit Polyclonal Antibody
TA375296

USD 220.00

3 Weeks

CYP46A1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-280 of human CYP46A1 (NP_006659.1).
Modifications Unmodified