Antibodies

View as table Download

EZH1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 162-208 of Human ENX-2.

Rabbit polyclonal anti-EZH1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EZH1.

Rabbit Polyclonal EZH1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EZH1 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human EZH1.

Rabbit anti-EZH1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EZH1

Rabbit Polyclonal Anti-EZH1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EZH1 Antibody: A synthesized peptide derived from human EZH1

Rabbit Polyclonal Anti-EZH1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EZH1 Antibody: synthetic peptide directed towards the N terminal of human EZH1. Synthetic peptide located within the following region: VDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKK

Rabbit Polyclonal Anti-EZH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EZH1 antibody: synthetic peptide directed towards the N terminal of human EZH1. Synthetic peptide located within the following region: MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQ

Rabbit Polyclonal EZH1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A portion of amino acids 350-400 of human EZH1 was used as the immunogen.

EZH1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human EZH1

EZH1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 160-280 of human EZH1 (NP_001982.2).
Modifications Unmodified