Antibodies

View as table Download

GATA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GATA1

Anti-GATA1 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.140~144 (R-L-S-P-D) derived from Human GATA1.

Anti-GATA1 (Phospho-Ser142) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 142 (R-L-S(p)-P-D) derived from Human GATA1.
Modifications Phospho-specific

Rabbit Polyclonal GATA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA1

Rabbit Polyclonal GATA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA1

Rabbit Polyclonal GATA1 (Ser142) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 142
Modifications Phospho-specific

Rabbit Polyclonal GATA1 (Ser310) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 310
Modifications Phospho-specific

Rabbit anti-GATA1 (Phospho-Ser142) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanGATA-1 around the phosphorylation site of serine 142 (R-L-SP-P-D).
Modifications Phospho-specific

GATA1 pSer142 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

GATA1 pSer310 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

GATA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

GATA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Rabbit anti-GATA1 (Phospho-Ser310) polyclonal antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanGATA1 around the phosphorylation site of serine 310 (K-A-SP-G-K).
Modifications Phospho-specific

Rabbit Polyclonal Anti-GATA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA1 antibody: synthetic peptide directed towards the N terminal of human GATA1. Synthetic peptide located within the following region: SGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCME

Rabbit anti GATA1(pS142) Polyclonal Antibody

Reactivities Human, Mouse
Conjugation Unconjugated

GATA1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human GATA1
Modifications Unmodified

GATA1 Rabbit polyclonal Antibody

Applications ChIP, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human GATA1