Antibodies

View as table Download

Rabbit polyclonal anti-Ga15/16 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 356of human G 15

Rabbit Polyclonal Anti-GNA15 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNA15 antibody: synthetic peptide directed towards the N terminal of human GNA15. Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG

G protein alpha 16 (GNA15) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 340-369 amino acids from the C-terminal region of human G protein alpha 15

GNA15 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 112-374 of human GNA15 (NP_002059.3).