Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HOXA3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA3 antibody: synthetic peptide directed towards the C terminal of human HOXA3. Synthetic peptide located within the following region: MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPAC |
Rabbit Polyclonal Anti-HOXA3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA3 antibody: synthetic peptide directed towards the middle region of human HOXA3. Synthetic peptide located within the following region: PPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHIQGSPVFVGGSYVE |
Hoxa3 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Rat Hoxa3 |
HOXA3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse HOXA3 |
Active filters
Target Symbol
- HOXA3
Antibody Hosts
- Rabbit