Antibodies

View as table Download

Anti-HTR3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic

Rabbit anti-HTR3A Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HTR3A

Rabbit polyclonal anti-5-HT-3A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-3A.

Rabbit Polyclonal 5-HT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 27-42 (RATQAHSTTQPALLRL) and 427-442 (LSSIRHSLEKRDEMRE) of rat 5-HT3 Receptor, accession number P35563.

5HT3A receptor (HTR3A) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human

Rabbit Polyclonal Anti-HTR3A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR3A antibody: synthetic peptide directed towards the N terminal of human HTR3A. Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV

5HT3A receptor (HTR3A) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 37-66 amino acids from the N-terminal region of Human Serotonin receptor 3A (HTR3A)

Rabbit polyclonal Anti-5-Hydroxytryptamine Receptor 3A

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RPVPDWLRHLVLDR, corresponding to amino acid residues 342-355 of rat 5-Hydroxytryptamine Receptor 3A (Accession P35563). 2nd intracellular loop.

Rabbit Polyclonal Anti-Htr3a Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Htr3a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH

Anti-HTR3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic

HTR3A Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human 5-HT-3A. AA range:161-210