Antibodies

View as table Download

Rabbit Polyclonal Anti-LAIR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human LAIR1

Rabbit Polyclonal Anti-LAIR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAIR1 antibody is: synthetic peptide directed towards the C-terminal region of Human LAIR1. Synthetic peptide located within the following region: LLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGL

Rabbit Polyclonal Anti-LAIR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAIR1 antibody is: synthetic peptide directed towards the middle region of Human LAIR1. Synthetic peptide located within the following region: GNAGPYRCIYYKPPKWSEQSDYLELLVKGPTQRPSDNSHNEHAPASQGLK

LAIR1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LAIR1

LAIR1 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LAIR1

LAIR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LAIR1
Modifications Unmodified