Antibodies

Jump to Filters
View as table Download
MAT2B (N-term) Rabbit Polyclonal Antibody
AP52614PU-N

USD 450.00

2 Weeks

MAT2B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 86~116 amino acids from the N-terminal region of human MAT2B
MAT2B Rabbit Polyclonal Antibody
TA342138

USD 375.00

5 Days

Rabbit polyclonal Anti-MAT2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the N terminal of human MAT2B. Synthetic peptide located within the following region: KEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAA
MAT2B Rabbit Polyclonal Antibody
TA342139

USD 375.00

5 Days

Rabbit polyclonal Anti-MAT2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT2B antibody: synthetic peptide directed towards the middle region of human MAT2B. Synthetic peptide located within the following region: GNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGE
MAT2B Rabbit Polyclonal Antibody
TA365226

USD 380.00

4 Weeks

MAT2B rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAT2B
MAT2B Rabbit Polyclonal Antibody
TA369543

USD 380.00

4 Weeks

MAT2B rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAT2B
MAT2B Rabbit Polyclonal Antibody
TA378358

USD 220.00

3 Weeks

MAT2B Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-334 of human MAT2B (NP_037415.1).
Modifications Unmodified