Antibodies

Jump to Filters
View as table Download
PAICS (N-term) Rabbit Polyclonal Antibody
AP53152PU-N

USD 450.00

2 Weeks

PAICS (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 94-123 amino acids from the N-terminal region of human PAICS
PAICS Rabbit Polyclonal Antibody
TA338988

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAICS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAICS antibody: synthetic peptide directed towards the N terminal of human PAICS. Synthetic peptide located within the following region: ATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLE
PAICS Rabbit Polyclonal Antibody
TA350264

USD 345.00

In Stock

Rabbit Polyclonal Anti-PAICS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PAICS
PAICS Rabbit Polyclonal Antibody
TA364911

USD 380.00

4 Weeks

PAICS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PAICS
PAICS Rabbit Polyclonal Antibody
TA379582

USD 220.00

3 Weeks

PAICS Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 176-425 of human PAICS (NP_001072992.1).
Modifications Unmodified