Antibodies

View as table Download

Rabbit anti-UBE2D1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2D1

Rabbit Polyclonal Anti-MKRN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MKRN1 antibody: synthetic peptide directed towards the N terminal of human MKRN1. Synthetic peptide located within the following region: GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE

UBE2D1 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UBE2D1

UBE2D1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UBE2D1

UBE2D1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UBE2D1