TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified
Applications | Assay, ELISA, FC, IHC, NEUT, WB |
Reactivities | Human |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified
Applications | Assay, ELISA, FC, IHC, NEUT, WB |
Reactivities | Human |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | Assay, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
Applications | Assay, ELISA, FC, IHC |
Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
Applications | Assay, ELISA, FC, IHC |
Reactivities | Human |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-JUN Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit polyclonal Anti-PRKCG Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SRF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRF antibody: synthetic peptide directed towards the N terminal of human SRF. Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM |