Antibodies

Jump to Filters
View as table Download
Hdac6 Rabbit Polyclonal Antibody
TA343577

USD 375.00

5 Days

Rabbit Polyclonal Anti-Hdac6 Antibody

Applications Assay, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hdac6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac6. Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
HDAC6 Rabbit Polyclonal Antibody
TA329290

USD 375.00

5 Days

Rabbit Polyclonal anti-HDAC6 antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC6 antibody: synthetic peptide directed towards the N terminal of human HDAC6. Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ