Hdac6 Rabbit Polyclonal Antibody

CAT#: TA343577

Rabbit Polyclonal Anti-Hdac6 Antibody

Product Images

WB Suggested Anti-Hdac6 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Testis

• 

  Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region and HCT116 Cells

Specifications

Product Data

• Applications: Assay, WB
• Recommended Dilution: WB, ChIP, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Hdac6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac6. Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 126 kDa
• Gene Name: histone deacetylase 6
• Database Link:
  NP_034543
  Entrez Gene 10013 HumanEntrez Gene 15185 Mouse
  UniProt ID Q9Z2V5
• Background: Hdac6 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Hdac6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.
• Synonyms: FLJ16239; HD6; JM21; KIAA0901; OTTHUMP00000197663
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Rat: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 85%