Rabbit Polyclonal anti-Rgs10 antibody
| Applications | FC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rgs10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE |
Rabbit Polyclonal Anti-RGS10 Antibody
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RGS10 antibody: synthetic peptide directed towards the middle region of human RGS10. Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT |
Germany
Japan
United Kingdom
China
