RGS10 Rabbit Polyclonal Antibody

CAT#: TA330397

Rabbit Polyclonal Anti-RGS10 Antibody

Product Images

WB Suggested Anti-RGS10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that RGS10 is expressed in Jurkat

• 

  bone marrow derived monocytes

Specifications

Product Data

• Applications: FC, WB
• Recommended Dilution: WB, FACS
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RGS10 antibody: synthetic peptide directed towards the middle region of human RGS10. Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: regulator of G-protein signaling 10
• Database Link:
  NP_001005339
  Entrez Gene 67865 MouseEntrez Gene 6001 Human
  UniProt ID O43665
• Background: RGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.
• Synonyms: OTTHUMP00000020597; OTTHUMP00000069158; regulator of G-protein signaling 10; regulator of G-protein signalling 10
• Note: Immunogen sequence homology: Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 90%; Rat: 90%; Bovine: 81%