Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RGS10 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RGS10. |
Antibodies
View as table Download
Rabbit Polyclonal anti-Rgs10 antibody
| Applications | FC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rgs10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE |
Rabbit Polyclonal Anti-RGS10 Antibody
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RGS10 antibody: synthetic peptide directed towards the middle region of human RGS10. Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT |
Rabbit Polyclonal Anti-RGS10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RGS10 antibody: synthetic peptide directed towards the middle region of human RGS10. Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT |
Carrier-free (BSA/glycerol-free) RGS10 mouse monoclonal antibody,clone OTI8H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RGS10 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RGS10 |
RGS10 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human RGS10 (NP_001005339.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
RGS10 mouse monoclonal antibody,clone OTI8H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
RGS10 mouse monoclonal antibody,clone OTI8H4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
RGS10 mouse monoclonal antibody,clone OTI8H4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
RGS10 mouse monoclonal antibody,clone OTI8H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- RGS10